publication . Article . 2009

Characterisation and expression of SPLUNC2, the human orthologue of rodent parotid secretory protein

Lynne Bingle; Frances A. Barnes; Hayley Lunn; Maslinda Musa; Steve Webster; C. W. Ian Douglas; Simon S. Cross; Alec S. High; Colin D. Bingle;
Open Access English
  • Published: 05 Jun 2009
  • Publisher: Springer Verlag
  • Country: United Kingdom
Abstract
We recently described the Palate Lung Nasal Clone (PLUNC) family of proteins as an extended group of proteins expressed in the upper airways, nose and mouth. Little is known about these proteins, but they are secreted into the airway and nasal lining fluids and saliva where, due to their structural similarity with lipopolysaccharide-binding protein and bactericidal/permeability-increasing protein, they may play a role in the innate immune defence. We now describe the generation and characterisation of novel affinity-purified antibodies to SPLUNC2, and use them to determine the expression of this, the major salivary gland PLUNC. Western blotting showed that the a...
Subjects
free text keywords: Cell Biology, Molecular Biology, Medical Laboratory Technology, Histology, Major Salivary Gland, Serous fluid, Innate immune system, Epitope, Salivary gland, medicine.anatomical_structure, medicine, Alternative splicing, Biology, Saliva, Plunc

58 LKVDLGVLQKSSAWQLAKQKAQEAEKLLNNVISKLLPTNT---DIFGLKISNSLILDVKA 61 SGGLLGILENLPLLDILKPGGGTSGGLLGGLLGKVTSVIPGLNNIIDIKVTDPQLLELGL 41 RADFLPSLQTTGLQKPLSSAFDGVSGLLDIFGPPLTNEIN----TVSIQVKNPQLLHVSI 49 KHNAESRIQNIHFGDRLNASAQVAPGLVGWLISGRKHQQQ---QESSINITNIQLDCGGI

Powered by OpenAIRE Research Graph
Any information missing or wrong?Report an Issue